PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_30486-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 313aa    MW: 34276 Da    PI: 7.862
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_30486-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.32.2e-32209265158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rkpylheSRh+hAl+R+Rg gGrF
  TRIUR3_30486-P1 209 EEPVYVNAKQYNAILRRRQSRAKAESERKL-IKGRKPYLHESRHQHALKRARGAGGRF 265
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-35207268IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.934208268IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.6E-26210265IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-23211233IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860213233IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.3E-23242265IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MAWGIDRGRE PCSSSSTFAV VVFKSQFTDA VSHNWLPDSR CSLVSEKISV WFCLKKHAYG  60
YGDTDTAIRI RCSTAELIDP LDPCRCNLQN TSNASISLLE SRDWRRHAAE DAGDHRADEQ  120
QKQAAAQGNQ EEAPATSIGS QAMVATPSTD YVTPYGHQEA CHAMGQIAYP TVDPFYGSLY  180
AAYGGQPMMH PPMVGMHAAA IPLPTDAIEE PVYVNAKQYN AILRRRQSRA KAESERKLIK  240
GRKPYLHESR HQHALKRARG AGGRFLNAKS DDNEEHSDSS SKDKQNGVAP RSSGQSSQSP  300
KGATSADKSG NHE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-21208281174NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787550.0KM078755.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-B5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237027.11e-115PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237028.11e-115PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_014758866.11e-115PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLM7ZU210.0M7ZU21_TRIUA; Nuclear transcription factor Y subunit A-7
STRINGMLOC_52315.11e-134(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65553853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.22e-38nuclear factor Y, subunit A7